SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7A6G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A6G1
Domain Number 1 Region: 153-428
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.14e-81
Family Mitochondrial carrier 0.0000245
Further Details:      
 
Domain Number 2 Region: 21-148
Classification Level Classification E-value
Superfamily EF-hand 1.55e-26
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7A6G1
Sequence length 435
Comment (tr|F7A6G1|F7A6G1_XENTR) Calcium-binding mitochondrial carrier protein SCaMC-1 {ECO:0000313|Ensembl:ENSXETP00000055073} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=slc25a24 OC=Silurana.
Sequence
LNSCFLSLSVLGIHSLQGKLHFQKIVAAGDTNKDGHLDFGEFIRYLEEHEKKMKIAFTSL
DKNKDGKIESAEIMNSLKTLGINISLEHAEKILKSMDADGTLTVDWNEWRDHFLFNPADN
IQQIIRYWKHSTVLDIGDSLTIPDEFTEEEKKTGQWWKQLLAGGMAGAVSRTGTAPLDRL
KVMMQVHGSKGNANIITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLF
TSESGKLGTAERFIAGSLAGATAQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREG
VRAFYKGYIPNILGIIPYAGIDLAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCG
QLASYPLALIRTRMQAQASIEGAPQLNMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVS
ISYVVYEKMKIKLGI
Download sequence
Identical sequences F7A6G1
ENSXETP00000055073 ENSXETP00000055073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]