SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7A6G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A6G7
Domain Number 1 Region: 50-518
Classification Level Classification E-value
Superfamily Sema domain 1.7e-152
Family Sema domain 0.0000000516
Further Details:      
 
Domain Number 2 Region: 514-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000174
Family Plexin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7A6G7
Sequence length 1076
Comment (tr|F7A6G7|F7A6G7_XENTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSXETP00000039840} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=sema6d OC=Silurana.
Sequence
MTLRAGCAWALLLTVSTVCAVSFPEDDEPINVVDYHYSRQYPVFRGRPSGNDSQHSLDFQ
LMLKIRDTLYVAGRDQVYAINLNEVPKTEVTPSRRLTWRSGQADRKNCAMKGKHKDECHN
YIKVFVPRNDEMVFVCGTNAFNPMCRYYRLNTFDYDGEEISGLARCPFDARQTNVALFAD
GKLYSATMADFQASDAVIYRSMGDGFALRTIKYDSKWLKEPHFLHAIEYGNYIYFFFREI
AVEHNNLGKAVHSRVARICKNDLGGSQRVLEKHWTSFVKARLNCSVPGDSFFYFDVLQSI
TDIIEINGIPTVVGVFTTQLNSIPGSAVCAFTMDDIEKVFRGRFKEQKTPDSVWTAVPED
RVPKPRPGCCARHGYGEGYRSSTEFPDETLSFIKSHPLMDSAIPSIIEEPWFTKTRVRYR
LTAVAVDHLAGPYLNYTVMFVGSEAGVVLKILAKTNPFSLNDSVLLEEIDAYNRAKCSGN
SEEDRKVISLQMDRDHHALFVAFSGCIVRLPLSRCERYGSCKKSCIGARDPYCGWLNHES
CGRVKPGMFFGYEQDVEYGNTVQLGDCHDILPTATTPDYKIFGDPTSDIEVPSTSVTTTS
SPVILPKVIGSWKPRMTGSRKFIYQDDPNTSEYIDPLTGVQKGVRWEVQSGDANQMVHMN
VLITCVLAAFVLGAFIAGVIVYCYREMFVRKTRKIHKDAESAQSCTDSSGSFAKLNGLFD
SPVKEYHQSIDSPKHYTNILTSRKELPPNGETKSMMMDSQGQPPELAALPTPESTPVLHQ
KSLQPIKNQWEKTHNNLNISRKETPLKSPQFFPSSPPPHSPLAHGQIPSAVVIPNATHDY
NTSFSNSNAHKSDKKLHNLEHSLGKQSSKRDHRRSVDSRNTLNDFLKHLNESAGNPKALM
GDIQVPHQTLMLDTMGNMSEVPPKVPNREASLYSPSSTLPRNSPTKRVDVPSTPNGQMTP
IESQRSYHKNSSQRHSISAMPKNMNSPNGVLLSRQPSINRGGYMPPSPSTRMDYMQGTPI
IVHQQTSLSRQSSYTGHGTLPRMGVKRTPSIKPDVPPKPSFTSQNTSVRQLNKYSY
Download sequence
Identical sequences F7A6G7
ENSXETP00000039840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]