SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7A896 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A896
Domain Number 1 Region: 209-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000172
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 2 Region: 272-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 155-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7A896
Sequence length 365
Comment (tr|F7A896|F7A896_HORSE) Netrin 5 {ECO:0000313|Ensembl:ENSECAP00000016747} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=NTN5 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MPVTFALLLFLSQATADPCYHPGGQPRFCLPPVTQLAGMAASCPQACALSPGADPGPRAT
CNGSLTLALGGPFLLTSISLRFCTPGPPALVLSASWATGGPWRSLWRRPAWPGALGGPEK
VTFRAPPPKSSVVSSHLRMEFGVRAGLAAGVRGRCQCHGHAARCAARARPPPRCRHHTTG
PGCESCRPSHRDWPWRPATPWHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCR
HHTAGRHCHYCQPGFWRDPSQPITSRKACRACQCHPIGATGGTCNQTSGQCSCKLGVTGL
TCNRCGPGYQQSRSPRMPCQRIPEATTTLSTTPGAYSSDPQCQNYCNISDTRVHMNLRRY
CQQDY
Download sequence
Identical sequences F7A896
ENSECAP00000016747 ENSECAP00000016747 9796.ENSECAP00000016747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]