SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7A973 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7A973
Domain Number 1 Region: 497-724
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-55
Family Kelch motif 0.00021
Further Details:      
 
Domain Number 2 Region: 224-346
Classification Level Classification E-value
Superfamily POZ domain 3.45e-27
Family BTB/POZ domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7A973
Sequence length 731
Comment (tr|F7A973|F7A973_XENTR) Kelch-like family member 29 {ECO:0000313|Ensembl:ENSXETP00000039492} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=klhl29 OC=Silurana.
Sequence
PVLSKTEKQAQGQLLATSVRWGQTPINQSTPWDTEEPPSKQMRKGENPATPPWVTTVSAG
TQASLIAHSYGMTQPPIYSQAANVQAPIIGVTPTLPPHVAPQLPLMTAHYQLQQHQQPAQ
PLSNMVVNLQSQTLYRHSQPMAVPSLTGVSQVPLPGHTAVGNGHMTCPLLPPPPPAQPSA
ALPNSVPDTNGQTAPQVPHSQTSNPDNPNGVQMLRTIGMGKYEFTDPWYPKEMLKELNQQ
RRAKEFTDLKIIVEGKEFEVHQNVLASCSLYFKDLIKRSSRDSAKNGEKLELTMSNINAE
VLELLLEFVYTGSLIIDSANAKILLEAANKFQFHTFCKVCVSFLEKQLTANNCLGILAMA
EAMQCVELYNMAKAYALQNFPEVANQDEILKISKEDFVSYISNDSLNTKAEELVYETVIK
WIKKDPGNRAQHSAELLAVVRLPFIHPSYLLNIVDNEELIKSSEACRDLVNEAKRYHMLP
HARQEMQTPRTRPRLSAGGMEAGVTLADVWCYMSLLDNWNLVSRMIVPRCRHNSVVYDGK
IYTIGGLGVAGNVDHVERYDTIINQWETVAALPKPVHSAAATVCGGKIYVFGGVNEAGRA
AGVLQSYIPQTNTWSFIESPMIDNKYAPAVTLNGFIFILGGAYARATTIYDPEKGNIKAG
PNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNMEFYDPKSNTWTLLPNMPCPLFRHG
CVVIKKYIQSG
Download sequence
Identical sequences F7A973
ENSXETP00000039492 ENSXETP00000039492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]