SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AAZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AAZ5
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily E set domains 1.68e-56
Family RhoGDI-like 0.0000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7AAZ5
Sequence length 150
Comment (tr|F7AAZ5|F7AAZ5_HORSE) Phosphodiesterase 6D {ECO:0000313|Ensembl:ENSECAP00000016113} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PDE6D OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSIPGVEHEARVPKKILKCKAVS
RELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
Download sequence
Identical sequences F7AAZ5
9796.ENSECAP00000016113 ENSECAP00000016113 ENSECAP00000016113 XP_003365184.2.31192 XP_004674257.1.23501 XP_014718000.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]