SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AD24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AD24
Domain Number 1 Region: 17-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000122
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 58-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 98-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7AD24
Sequence length 333
Comment (tr|F7AD24|F7AD24_HORSE) Low density lipoprotein receptor class A domain containing 3 {ECO:0000313|Ensembl:ENSECAP00000016702} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=LDLRAD3 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
SPAEGQLLPGNNFTNECNIPGNFMCGNGRCVPGAWQCDGLPDCFDGSDEKECPKAKSKCG
PTFFPCASGVHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFIC
DGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLAL
VLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCSVTYNVNNGIQYVASQAEQNASD
VGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSANSASSQAASSLL
STEEAGHSPGQPGPREGAAEPRDSVPSQGPEEV
Download sequence
Identical sequences F7AD24
9796.ENSECAP00000016702 ENSECAP00000016702 ENSECAP00000016702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]