SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AEE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AEE9
Domain Number 1 Region: 172-448
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-86
Family Eukaryotic proteases 0.0000011
Further Details:      
 
Domain Number 2 Region: 61-124
Classification Level Classification E-value
Superfamily GLA-domain 2.86e-22
Family GLA-domain 0.00041
Further Details:      
 
Weak hits

Sequence:  F7AEE9
Domain Number - Region: 114-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000415
Family EGF-type module 0.0058
Further Details:      
 
Domain Number - Region: 147-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7AEE9
Sequence length 460
Comment (tr|F7AEE9|F7AEE9_MONDO) Protein C, inactivator of coagulation factors Va and VIIIa {ECO:0000313|Ensembl:ENSMODP00000023291} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PROC OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MATRRQHCQSSTAHICVSFSKMWQFVSFLVFVASWYSPGGHGMSVFSSSKDANQILRIQK
RANSFLEEIKPGNLERECYEEICELEEVTEIFVTREETLAFWSKYMDGDLCDPQPCPNGT
CIDGIGSFQCICKEGWEGRLCGHEVSYTNCSINNGGCAHYCTEDLQNQQRHCSCALGYQE
SDNPMECDPIANFPCGKPKVNYPIIDFDQLQIRILGGKSTNKGDSPWQVILLDLEGKLKC
GGVLIHSSWVLTAAHCVENPKKLTVRLGEHDLRRYDNSEMDFHIREAIVHPNYTKSTSDN
DIALLYLDKPTIFSKNILPICLPNLGLAHRELMKVGREMVITGWGRQREESRNRTYVLRF
TKIPLASHDECSQTMHNRVSENMLCAGILRDKRDACEGDSGGPMVTEFRGTWFLVGLVSW
GEGCGRPDTFGIYTKVSQYLNWIRDHIKAKEAILKNDSAP
Download sequence
Identical sequences F7AEE9
ENSMODP00000023291 ENSMODP00000023291 XP_001377216.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]