SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AFR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AFR9
Domain Number 1 Region: 191-279
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000682
Family UBX domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7AFR9
Sequence length 283
Comment (tr|F7AFR9|F7AFR9_MONDO) UBX domain protein 10 {ECO:0000313|Ensembl:ENSMODP00000019846} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=UBXN10 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MATEAPLKIALSECSPALDPEAAFIWQPSPVTMHVTRPKSAKGRTRTNLNYSHSSESSSY
RKPPSPAPTAPGDGPGSQKPVSSAPKPPNQGAPDEIPELLQQVPVGSSSSLNKYRVLPSI
NRKNLEDGAVDTVAKQASTLKLSSLQELKALCREEACSGKSREGCLRAPAPPLESKPCSR
TKERNVSLVGNLEEPSDGEPRLLLAVRSPSGQRFVRHFRPTDNLQTVVAVAEQKNLTTYH
HCSIETMEVPRRSFSDLSKSLEECGIPHKSVLGILQEEREGQP
Download sequence
Identical sequences F7AFR9
XP_007491324.1.35504 XP_007491326.1.35504 XP_007491327.1.35504 XP_016277559.1.35504 ENSMODP00000019846 ENSMODP00000019846 13616.ENSMODP00000019846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]