SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AJ67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AJ67
Domain Number 1 Region: 337-611
Classification Level Classification E-value
Superfamily Kelch motif 5.49e-61
Family Kelch motif 0.00021
Further Details:      
 
Domain Number 2 Region: 40-151
Classification Level Classification E-value
Superfamily POZ domain 3.05e-30
Family BTB/POZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7AJ67
Sequence length 629
Comment (tr|F7AJ67|F7AJ67_XENTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSXETP00000040965} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=klhl41 OC=Silurana.
Sequence
ALGAARSRGLSVSPANACSSGNKMDPTGEIKDELRLYQSTLLQDGLKELLDENKFVDCFL
KAGSKSLPCHRLILAACSPYFREFFLSDESEEKKKNMELDNVEPSTMEAILKYLYSADID
LNDGNVQDIFALASRFQIPSVFTVCVTYLQRRLSPANCLAIFRLGLLLDCPRLAVTARDY
VCDRFMQICNEEDFLQLAPHELIAVISSDGLNVEKEELVFEAIMKWVQTDKENKTKSLSD
VFDCIRFRLMPEKYFTDKVEKHDLIKANPDIVKKVKVIKDAFAGKLPEGSKGKENSGKEG
EDGDVGDEDLLPGYLNDIPRHGMFVKDLMLLVSDTAAVAYDPLENECFLVGLSEQIPRNH
SSIVTKSNQVYVIGGLYVDEENKDQPLHSYFFQLDSIAGDWIGLPPLPSARCLFGLGEAD
DCVYAIAGRDLQSEESLDSVFCYDSKAVAWTEVKKLPIKVYGHSAVSHNSQIYCLGGKTE
DKKCTGRMFVFNPKKGEWKDLPPMRTSRSMFGVTVHKGKIFVVGGVTEEGLTASVEAYDI
ATNKWETLAEFPQERSSINLVSVGGSLYAVGGFAMIQLESKEFAPTEVTDVWKYEDDKKE
WSGMLKELRYAAGATCLDTRLNLFKLTKL
Download sequence
Identical sequences F7AJ67
ENSXETP00000040965 ENSXETP00000040924 8364.ENSXETP00000040965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]