SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AJF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AJF2
Domain Number 1 Region: 2-460
Classification Level Classification E-value
Superfamily Sema domain 7.19e-119
Family Sema domain 0.0000623
Further Details:      
 
Domain Number 2 Region: 1555-1682,1871-2057
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.43e-46
Family p120GAP domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 1128-1219
Classification Level Classification E-value
Superfamily E set domains 9.55e-16
Family Other IPT/TIG domains 0.049
Further Details:      
 
Domain Number 4 Region: 1033-1126
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000215
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 463-515
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000102
Family Plexin repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  F7AJF2
Domain Number - Region: 617-650
Classification Level Classification E-value
Superfamily Plexin repeat 0.00275
Family Plexin repeat 0.01
Further Details:      
 
Domain Number - Region: 1218-1267
Classification Level Classification E-value
Superfamily E set domains 0.0229
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.058
Further Details:      
 
Domain Number - Region: 995-1029
Classification Level Classification E-value
Superfamily Plexin repeat 0.0314
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7AJF2
Sequence length 2090
Comment (tr|F7AJF2|F7AJF2_XENTR) Plexin B1 {ECO:0000313|Ensembl:ENSXETP00000038644} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=plxnb1 OC=Silurana.
Sequence
AFVQNNTIFNHLTLDANTGTLYVGATNSLYQLTENLAVEMLVRTGPVWDSKECLPPVSTD
CPQAQNTNNHNKLLLVVPSKRELIVCGSVYQGICESRRLGSVQTVLFRPERPVDTQYVAA
NDPNVTTVGLVALSKDGSPLLFVGRGYTSKGAGGIPPITTRNLEVGGDSEMESHSVFSYE
DTAKLAVVGRLSEYNHHFIKAFTHKSNVYFLFYRRDLKSQSREYKTYISRICPNDSHYYS
YVELPLSCRTKDKSYNLLQAAYVTQPGERLAKGVLKTDGDVLFAAFSQWQAASGKVGEES
GLCLYSMDLIDRLINQTRDTCYTKDGKAEDGREVAYIEYDVKSNCVQLPSDTLDAYPWGW
DHTPSPMASKDPREATPLFESVTTGFTAIAGHGEGEHTIAFIGDSKGYLKRVYLGGEQDT
RQYSSVGTQSNSAVLPDLLFDQEEKHLYILTQSTVMKVPLSECSTFTDCDSCLSAGDPYC
GWCVLYGKCSRSYECLRSGQKNQWLWAYDQNQQCLAVQSLSPANISKEEKRNIFLSIPDL
PALEHEESYSCFFEDFESRAVIRDTGVMCPSPDPSKTPAIKPGTDHVQVKLVLRFGEVTI
CSTEFTFYDCMAVAQLYKNAPCRGCVSSDWGCNWCIQQHHCTHKATCEEGTIIYNKLVTI
PSLLIMLSTTIPTTLPVTTPATTPTTVLQPDPSTAILDLATEDTIPDITMEPSTEEPTSR
PTTIPTTMTTTPVPVPPPTTPETQEEHPWVPTILHPTQEELTSTGQPITTPNQASSVSSL
PGSPDEFHSEIPFSEEPPTVPSEDGTEENLDQTEADDWADSASMDNDTSSFSASTILSGD
GESDGVSPSFPGILEPDLDYQFDSPGLFEMDEEELIWGPEACPCVESIQSASLLPVNVER
KITLVGKNFHHYQDQQMDYDCVLLLEGRTVVTDAVLELDPEEESKYYITCQLHQYSYSAL
QLEFNAMVFVRIQSYLRVDSAEDLYVTLYNCSVGHPDCSRCQTADPKYNCVWCGGSHPNC
MYQETCKEKVEGTCPAPLIHSIEPLSGPMEGGTRITITGSNLGQKLEDIVDTVTVAGIQC
QVDLLRYEISSRIVCVIASSLTERLGHVAVEVPGGGHGISSQVFSYFFQNPVLHSFSPTR
GPKSGGTRLTLTGTKLLTGRPSDITVLIGDIPCHIYSEMQENMLECLTGSSNSTADLQVT
IKYGDQVLRTYESPFTYTADPNITSASPAKSFISGGRMIFVSGNLEVVQAPKIRVTVSPR
ERRRKRSLSRHRRIVPETECPENALCTVEKVFFPVFPFCPLSFCINVCFILNYSYYSGGR
QSPSFPIIPTPNAFYLHPLLDSCPYRVAGGASVLSWYGENLDLAITKDEMVAMIGDGVCM
VKTLTRNHLYCEPPEKQPAPRQPQKREGVDSLPEFTVQIGRMYLVLGKVQYDTESQLTFP
LEAQIGLGVGTSFVALIVLIIVLIYRRKSKQALRDYKKVQIQLENLETSVRDRCKKEFTD
LMTEMMDLTSDLVGTGIPFLDYKSYAERIFFPGHRESPLQRDLDVPEGRRQTVEQGLVQL
SNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVSLHGKLEYFTDILKTLLNDLVEQ
YVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSAGEPLYMLFRGIKHQVDKGPVDCV
TGKAKYTLNDNRLLRDDVEYKTLTLNAIMQTNTGITCEEEAQGLPVKLLDCDTITQVKEK
ILDQIYKGTPYCNRPNPEALDLEWRSGLAGHLILSDEDLTSVVHGSWKRVNTLQHYKVPD
GATVALVPRLSKHIHPENHDYIPGEKTPMLEDSDEGGVRVWHLVKPTDEPELPKHRRGSL
RDRERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAISH
GINDPETIHIWKTNSLPLRFWINIIKNPQFVCDVQTSDNVDAVLSVIAQTFMDSCTIADH
KLGRDSPINKLLYARDIPRYKQMVERYYSDIRQTISASDQEMNSALAELSRNCSGELNSL
VALHELYKYINKYYDQIIEALEEDPTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences F7AJF2
ENSXETP00000038644 ENSXETP00000038644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]