SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AKI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AKI8
Domain Number 1 Region: 412-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000251
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 603-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000519
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 705-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 641-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000104
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 348-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 312-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000392
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 271-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 682-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  F7AKI8
Domain Number - Region: 567-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 388-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0311
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7AKI8
Sequence length 1192
Comment (tr|F7AKI8|F7AKI8_HORSE) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=JAG1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
QVCGASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCARDECDTYFKVCLKEYQSRV
TAGGPCSFGSGSTPVIGGNTFNLKGSRGNERNRIVLPFSFAWPRSYTLLVEAWDSSNDTV
QPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDF
FGHYACDQNGNKTCVEGWMGPECNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCI
PHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPE
GYSGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHG
GTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNAKSCKNLIASYYCDCLPGWMGQN
CDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEI
NRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDH
CRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYC
HENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGSCRDLV
NDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNS
SCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNWYRC
ECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCICPPGHSGAKCQEVSGRPCITM
GSVIPDGAKWDDDCNACQCLNGRIACSKVWCGPRPCLLHKGHSECPSGQSCIPILDDQCF
VRPCTGVGECRSSSLQPVKTKCSSDPYYQDNCANITFTFNKEMMSPGLTTEHICSELRNL
NILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNS
SLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVAWICCLVTAFYWCVRKRRKPSSHARSA
SEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMDKHQQ
KARFAKQPAYTLVDREEKPPNGTPAKHPNWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences F7AKI8
9796.ENSECAP00000011574 ENSECAP00000011574 ENSECAP00000011574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]