SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AKQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AKQ1
Domain Number 1 Region: 939-1066,1098-1303
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.06e-79
Family p120GAP domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 6-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.52e-38
Family Calponin-homology domain, CH-domain 0.0000212
Further Details:      
 
Domain Number 3 Region: 1536-1633
Classification Level Classification E-value
Superfamily RGC domain-like 1.44e-33
Family RGC domain 0.00000523
Further Details:      
 
Weak hits

Sequence:  F7AKQ1
Domain Number - Region: 654-684
Classification Level Classification E-value
Superfamily WW domain 0.000506
Family WW domain 0.0033
Further Details:      
 
Domain Number - Region: 715-766
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00223
Family Motor proteins 0.013
Further Details:      
 
Domain Number - Region: 778-828
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0266
Family Motor proteins 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7AKQ1
Sequence length 1633
Comment (tr|F7AKQ1|F7AKQ1_XENTR) IQ motif-containing GTPase-activating protein 2 {ECO:0000313|Ensembl:ENSXETP00000007241} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=iqgap2 OC=Silurana.
Sequence
MDERRRQNIAYEYLCHLEEAKRWMEACLVEELPPTTELEEGLRNGVYLAKLGRFFAPKVI
SEKKIYDVDQTRFKRSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRKNIPRVIY
CIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFNKIGGILANEL
SVDEAALHAAVIAINEALDKGVASQTMVTLRNPNAMLLNVEERFAEEYQNVLAQAKKIKE
DNAKNNTISEEERDVYEELLTQAEIQGHITKVNTNVALVQVNEAIDRKDEVALLNGLMLP
ILSLFEVQPKNSSWYLAQLCNTKEQKTQKAGAPSILDKNEIQKDVSVANKEAEAHVLMLE
AVEKINAALLSGDSSQTLAALQLPEAQMPTVHPFAETLYHMELQSLQKQNPANYLTQEEL
FIAVEMLSAVALVNQALETNDFNAVQTHLASQAIGLNNLEEDNMQRYTGTLASLRKEALH
QGQSYLGWTEIQKCIDGVNDEIQEENERIIAIGFINDAIVQGDPKSTLEALLAPQAKLLD
VSQENACHYQDVLQQAKAQKCKESEDESAALWLDEIQKGIHNANQDREDAQTLASGVAEI
NLALEKDDAQQTLMALQCSKTRLKGVLPECSEVYHKDLCEAKTQKTTEEVDESLWLKIRV
KDKYDYYYNVETKEGCWAQPEGITPKHSWLTREEIQLVVGKITADYNREQLWMANENLII
LLQAQIRGYLLRKAFNERKAYLHKQEPSAVKLQACWKGYKQRKSYTDRLKLLQANIVGIV
KIQSWFRMLKARKEFQKRLQYFTDHEKEIITIQAFLRANKAREDYRTLISSEEPPLNVVR
KFVYLLDQSDLDFHEELEKGKIDRRIIKKTNTSFAYDRFFSAIDLKVGLLRLRMCMSVQD
VVSHSKKLNKKSKGQVEEMLTVDKQGIKGLSKEKRKKLEAYQHLFYLLQTNPTYLAKLIF
QMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFETALQEEIKSKVDQIQDIVTGNPTV
IKMVVSFNRGARGQNTLRQLLAPVVKEIIEDKSLIINTSPVEVYKAWVNQLEMATGEASK
LPYDVTTEQALSHPEVVSKLESSIQSLRVVTDKVLQSIFSSLDLIPYGMRYIAKVLKNSL
HEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFDIIDITAGGQIHSDQRRNLGSVAKV
LQHAASNKLFDGENAHMSSMNPYLSQTYQKFRKFFQSACEVPEPEEKFNIDEFSDLVTLS
KPVIYISIEEIINTHSLLLEHQDAISPDHNDILHELLEALGTVPDVESFLGEGAVDSNDP
NKENTLSQMAKTEISLSLTSKFGLREGEDKDMKSLMIKTKKLIVDVIRTQSGETITEILE
TPASVPQENEHLMVIEKRAAFDAKTPDKMKRSHSVFEDGQLPLEQKKRKILRNLRTLEQA
GLVTEESKYQEIINEIAKDIRNQRRYRQCRKAELVKLQQTLNALNSKTAFYQEQINYYNT
YIKTCLDNLTRKNSRRSIKFDGKAEEKGSKKTKQATLKYTAARLHEKGVILEIEGLQTNQ
FKNVLFDITPGDEVGDFEVKAKFLGVEMEKVQLHFQDLLQMQYDGVAVMKMFDKAKVNVN
LLIFLLNRKFYGK
Download sequence
Identical sequences F7AKQ1
ENSXETP00000007241 ENSXETP00000007241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]