SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ALE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ALE5
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 2.23e-48
Family C-type lysozyme 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7ALE5
Sequence length 159
Comment (tr|F7ALE5|F7ALE5_CALJA) Lysozyme E {ECO:0000313|EMBL:CDM98767.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LYZE OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MQAWGTVVVTLAILMVVTVDAKIYERCELAARLERAGLNGYKGYSVGDWLCMAHHESGFD
TTFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIMCAKKIVS
SQNGLSAWTSWRRHCSGHDLSQWLKGCAMQVKTDPKNYP
Download sequence
Identical sequences F7ALE5
ENSCJAP00000028737 XP_002762877.1.60252 ENSCJAP00000028737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]