SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ALL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ALL5
Domain Number 1 Region: 3-78
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000468
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7ALL5
Sequence length 80
Comment (tr|F7ALL5|F7ALL5_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000003443} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
GADVEAVRRAGEQLNGRWMDFCRLLADRLSWLEYQGSILTFYKELQELEQAVSSAESWWR
SQLPPAADTAAVRTQLESCN
Download sequence
Identical sequences F7ALL5
ENSOANP00000003443 9258.ENSOANP00000003443 ENSOANP00000003443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]