SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AME1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AME1
Domain Number 1 Region: 248-501
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 9.03e-70
Family Creatinase/aminopeptidase 0.0000036
Further Details:      
 
Domain Number 2 Region: 66-247
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 2.98e-40
Family Creatinase/prolidase N-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7AME1
Sequence length 507
Comment (tr|F7AME1|F7AME1_HORSE) X-prolyl aminopeptidase 3 {ECO:0000313|Ensembl:ENSECAP00000016082} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=XPNPEP3 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MLWLLSAAKLVPAVVSARSLSGCVSCSQRRYSLQPIPERRVPNRYLGQPSPFTHPHLLRP
GEVTPGLSQVEYALRRHKLMSLIHKEAQGQSGTDQTVVLLSNPTYYMSNDIPYTFHQDNN
FLYLCGFQEPDSILVLQSLPGKQLPAHKAMLFVPRRDPSRELWDGPRSGTDGAIALTGVD
EAYTLEEFQHLVPKLKAETNMVWYDWMRPSHAQLHSDYMQHVTEVKARSKNKVRAVHQLV
QRLRLVKSPAEIERMQIAGKLTSQAFIETMFASKAPVEEGFLYAKFEFECRARGADILAY
PPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAEL
YEAVLEIQRGCLTLCSPGTSLENIYTMMLTLIGQKLKELGIMKNIKEDNAFKAARKYCPH
HVGHYLGMDVHDTPDMPRSLPLQPGMVITVEPGIYIPEDDRDAPEKFRGLGVRIEDDVVV
TQDSPLILSADCPKEMNDIEQICSRAS
Download sequence
Identical sequences F7AME1
ENSECAP00000016082 9796.ENSECAP00000016082 XP_001502337.1.31192 XP_005606721.1.31192 XP_005606722.1.31192 XP_005606723.1.31192 XP_005606724.1.31192 ENSECAP00000016082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]