SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AMP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AMP0
Domain Number 1 Region: 182-281
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-17
Family SH2 domain 0.001
Further Details:      
 
Domain Number 2 Region: 39-92
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000767
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 123-178
Classification Level Classification E-value
Superfamily SH3-domain 0.000000172
Family SH3-domain 0.0035
Further Details:      
 
Weak hits

Sequence:  F7AMP0
Domain Number - Region: 1-49
Classification Level Classification E-value
Superfamily PH domain-like 0.017
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7AMP0
Sequence length 322
Comment (tr|F7AMP0|F7AMP0_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000001997} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
LIHLQGKQGFQIFCKTKDRKRKWMEQFERAMSNLKPEKANANHHNFQMNTFDKTTNCEAC
KMFLKGTFCQGYLCTKCGVGAHKDCLEAFPSCNIRSPEYLDTLSMRVLPKLGTVQSYHDI
PSPPGKSGLTCQGGDVFELLRGPPDSQWEEGRLMQTQESGSFPSSSVKPCPSPSSRVLSR
ETVYSRYPCFAGKMEREDTEKVLQSPKSGTYLIRERPKLSHFLNIKFKYEMKHIKVVKKA
NSFYVTESKMFESLLDLFEYYQCHSLKEDSEDLDTTLESPYKFPLRSCSKASTWSRGYNP
HVIGMTLAINNVAARDLSELPL
Download sequence
Identical sequences F7AMP0
13616.ENSMODP00000001997 ENSMODP00000001997 ENSMODP00000001997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]