SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AN24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AN24
Domain Number 1 Region: 39-218
Classification Level Classification E-value
Superfamily vWA-like 6.53e-39
Family Integrin A (or I) domain 0.0000000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7AN24
Sequence length 488
Comment (tr|F7AN24|F7AN24_HORSE) Anthrax toxin receptor 2 {ECO:0000313|Ensembl:ENSECAP00000016060} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=ANTXR2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MVAGLSLARSPGSWLVPGLWLLVLSGPGGLVSAQEQPSCRGAFDLYFVLDKSGSVANNWI
EIYDFVKQLTERFVSPQMRLSFIVFSSQATIILPLTGDRGKISQGLEDLKHVRPVGETYI
HEGLKLANDQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKLSRSLGARVYCVGVLD
FEQAQLERIADSKEQVFPVTGGFQALKGIINSILAQSCTEILELRPSSVCVGEEFQIVLN
GRGFNLGSRNGSVLCTYTVNETYTKSVQPVSVELNSMLCPAPTLNKAGETLDVSVSFNGG
KSVISSSLIVTATECSNGIAALIAILVLLLLLAIGLMWWFWPLCCKVVIKDPPPPPPPAP
KEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVTIPE
ETEEPVRPRPPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEGRCI
NFSRVPSQ
Download sequence
Identical sequences F7AN24
ENSECAP00000016060 ENSECAP00000016060 XP_001492635.1.31192 XP_008516753.1.77740 XP_008516754.1.77740 XP_014691796.1.49734 9796.ENSECAP00000016060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]