SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AN62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AN62
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.36e-53
Family ENTH domain 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7AN62
Sequence length 608
Comment (tr|F7AN62|F7AN62_MACMU) ENTH domain containing 1 {ECO:0000313|Ensembl:ENSMMUP00000006486} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ENTHD1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAFRRQVKNFVKNYSDAEIKVREATSNDPWGPSSSLMLDISDLTFNTISLSEIMNMLWHR
LNDHGKNWRHVYKSLTLMDYLIKNGSKKVVQHCREGFCNLQTLKDFQHIDEAGKDQGYYV
REKSKQVITLLMDEQLLCKEREVACRTRQRTSYSMLFSKRPLGSSSSLTARTSAPTSDIS
ASEKKCKLPKFGRLRNKKNVCKAELKQEHCQDLHLPTETMLSQETLPLKIHGWKSTEDLM
TFSDDDPKLPLLATPPSIVSPITCLSEAAEVCNLLGADAVPTVSENSPSGQTDVSLDKRS
DGTLTNTVTENLLETPLEKQSAAEGLKTLTILPACWSSSKEEFISPNLRISKSNSTFHNQ
ASVETLYLSPSFKIFDPAKETVINKACQKPPQSSIQMDDKILKTTTWVSTASEGASSFSP
LSMSSPDLASPEKSAHLLSPILAGPSFWTLSHQQLSSTSFKEEDKTTKLHHSFASRGPVS
SDAEENDSLNLLGILPNNSDSAKKNVSHISSRHWGEFSTQNVDQFIPLSCSGFQSTKDFP
REPEAENSISVLLREVKCAIARLHEDLSTVIQELNVINNHLMSMSLNSSQISQSSQAPQS
SEGSSDQI
Download sequence
Identical sequences F7AN62 G7PFL3
ENSMMUP00000006486 9544.ENSMMUP00000006486 XP_001099911.1.72884 ENSMMUP00000006486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]