SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AQZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AQZ5
Domain Number 1 Region: 2-97
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.66e-19
Family Hormone receptor domain 0.0025
Further Details:      
 
Domain Number 2 Region: 94-396
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000357
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7AQZ5
Sequence length 397
Comment (tr|F7AQZ5|F7AQZ5_CIOIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000022112} KW=Complete proteome; Reference proteome OX=7719 OS=Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MKYKEQCEKSLNETLKNFENQTFCPGFFDRQICWPHTPAGQLSTEPCPSYIEWRNVIHLQ
ESLVAYRFCEFDGSWMVRNDTGQSVQWVNRIQCDVATNGLQYELGPLEIFDVVIKIYTAG
YIFSLVCMVIALFILMFFKKLHCTRNYIHMNLMLSFIVRYVAVMVKDKVLEDHYAVGQTN
LTQMEMSQYCDDVAGTDGLMVSCRLVITLMHYAIIANYFWLLVEGVYLQLLLVFVMTEYK
YFPIFMAFGWGAPWIPIGIWVAFRITFENVGCWEIYNALRTWWILSAPILISIAINFIIF
INIIRMIVSKLRANNMTRSDYKYRLARSTLALIPLLGIHYIIFMGVSDSVTNSTITKTKF
AFELILTSLQGSIIAILYCFLNGEVQTEIRKCWRNWR
Download sequence
Identical sequences F7AQZ5
ENSCINP00000022112 ENSCINP00000022112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]