SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AS02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AS02
Domain Number 1 Region: 33-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.92e-45
Family Frizzled cysteine-rich domain 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7AS02
Sequence length 170
Comment (tr|F7AS02|F7AS02_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000004071} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN= OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPP
Download sequence
Identical sequences F7AS02
ENSECAP00000004071 ENSECAP00000004071 9796.ENSECAP00000004071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]