SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ASJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ASJ2
Domain Number 1 Region: 871-1172
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.93e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000013
Further Details:      
 
Domain Number 2 Region: 212-354
Classification Level Classification E-value
Superfamily PH domain-like 4e-33
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 105-210
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-19
Family Second domain of FERM 0.00064
Further Details:      
 
Domain Number 4 Region: 19-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-18
Family First domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7ASJ2
Sequence length 1176
Comment (tr|F7ASJ2|F7ASJ2_HORSE) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000934} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=PTPN21 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
LPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELREIT
YFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTIYFGVVFYVPSVSQLQQEITRHQYYL
QLKKEILEGTSCTLESIQLAGLAVKQSDFGDFDQYESQDFLQKFALFPVGWLQDEKILEE
ATQKVALLHQKYRGLTAPDAEILYMQEVERMDGYGEESYPAKDSQGSDISIGACLEGIFV
KHKNGRPPVIFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVARHKF
YRLNQCSFQSDLMNPIRRRSSSRMSLPKPQPYVMPPPPQLHYNGHYTEPYTSSQDNLFVT
NQNGYYCHSQTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQPYMQPSPMSSNPSITGSD
VMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGMAHAERQSHSLRNLSIGNSYAYSR
PDALVYSQPEIREHAHFTSPQSAHYPFNLNYSFHSQSPYPYPAERRPVVGAVSVPELTNV
QLQAQEYPAPNIMKTQVYRPPPPYPYPRPANSTPDLSRHLYISSSNPDLITRRVHHSVQT
FQEDSLPVAHSLQEVSEPLTSARHAQLQKRNSIEIAGLTHSFEGMRLKERTMSASAADPN
VFIERTKQEETDEQESLRYGHKKSSDATMLIHSSEEEEDFEEESKAQAALPLRAREPRGG
YSQDLQPSYASVPRARPKEGPWPRGSWQLGLLRTYQTQPLPPLPWCHVWVHAPSSPVSWR
SILKTEINGRQAGTFWNSPPISTSRDLIKSLTSKETAFLHLFALEEKIIGFQMYNQNAAG
MKKSRVDAKKIGPLKLAALNGLSLSRLPLPDEGNEVPTRATNDERCKILEQRLEQGMVFT
EYERILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKV
SVSGIEWDYIATQGPLQNTCQDFWQMVWEQGVAIIAMVTAEEEGGREKSFRYWPRLGSRH
NTVTYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFL
SYLEEIQSVRRHTNSTSEPKSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDIPR
VLDMLRQQRMMMVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences F7ASJ2
9796.ENSECAP00000016036 ENSECAP00000016036 ENSECAP00000016036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]