SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AUN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AUN4
Domain Number 1 Region: 8-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-52
Family Calnexin/calreticulin 0.000000408
Further Details:      
 
Domain Number 2 Region: 144-248
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.92e-33
Family P-domain of calnexin/calreticulin 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7AUN4
Sequence length 268
Comment (tr|F7AUN4|F7AUN4_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000020352} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
RGPRSGFSARLNKPFTFDTKPLIVQYEVNFQSGIECGGAYVKLLSRTPELNMDQFHNKTP
HTIMFGPDKCGEDYKLHFIFRKNPKTDIYEEKHAKRSDMDLKTYFTDKKTHLYTLVLNPD
NSFEILVGQMVVNSGNLLNDMTPPVNPPQEIEDPNDQKPEDWDERPKIPDDVVKPDDWDG
TVPAKIPDEDATKLEGWLDDEPEYVYDPDAEKPENWDEDMDGEWKAPQIANSKCESAPGC
GVWTWDIPYMLKPRKTSRFHYQQIPVKH
Download sequence
Identical sequences F7AUN4
13616.ENSMODP00000020352 ENSMODP00000020352 ENSMODP00000020352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]