SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7AUN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7AUN7
Domain Number 1 Region: 391-567
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.04e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 569-669
Classification Level Classification E-value
Superfamily E set domains 7.31e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7AUN7
Sequence length 917
Comment (tr|F7AUN7|F7AUN7_HORSE) Nuclear factor of activated T-cells 2 {ECO:0000313|Ensembl:ENSECAP00000016679} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=NFATC2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MPRPSARADGGDAPGHEPGGSPQDEFDFSMLFDYVYLNPIEEEPNAHKVASPPSGLAYPD
DVLDYGLKPYSPLASLSGEPPGRFGEPDRGGPQNFLSPAKPAGASGLSPRIEITPSHELM
QAGGPLRGRDTGLLVEQPPLPGVAASPRVTLPVPGFEGYREPLCLSPASSGSSASFISDT
FSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPA
SRSSSPGAKRRHSCAGPLVAPLPGASPQRSRSPSPQPRDDGAPAGYPPTAGSAVLMDALN
SLAADSPCGIPPKMWKTSPDPSPVSAAPSKAGLARHIYPAVEFLGPCEQEERRNSAPESI
LLVPPTWPKQLVPALPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYETEG
SRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTS
YEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRV
HIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAESK
VLFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTSVKVNFYVINGKRKRS
QPQHFTYHPVPAIKTEPTDEYNPTLVCSPGHGGLGSQPYYPQHPMVAESPSCLVATMAPC
QQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLALADAHRSVLVHA
GSQGQGSAALHPSPAGQQASPVIHYPPAGPQLRCGGRQEFQHIMYCENFAPGSARPGPPP
AGQGQRLSPGAYPTVIQQQNAPSQRAAKNGPPVSDQKEVLPTGVIIKQEQNLDQTYLDDV
NEIIRKEFSGPPARNQT
Download sequence
Identical sequences F7AUN7
ENSECAP00000016679 ENSECAP00000016679 9796.ENSECAP00000016679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]