SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7B2N9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7B2N9
Domain Number 1 Region: 797-1069
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.44e-43
Family Protein kinases, catalytic subunit 0.0000212
Further Details:      
 
Domain Number 2 Region: 490-770
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.18e-41
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 3 Region: 355-458,495-520
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000154
Family SH2 domain 0.0028
Further Details:      
 
Domain Number 4 Region: 263-343
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000107
Family Third domain of FERM 0.02
Further Details:      
 
Weak hits

Sequence:  F7B2N9
Domain Number - Region: 125-203
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0607
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7B2N9
Sequence length 1082
Comment (tr|F7B2N9|F7B2N9_HORSE) Tyrosine-protein kinase {ECO:0000256|PIRNR:PIRNR000636, ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=JAK3 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MEPPSEETPLIAQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDHSAEELCVRAAKA
SAILPVYHSLFALATEDLSCWFPPSHIFSVEDAGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLLSGRLPVGLGLKEQGECLSLAVLDLARMAREQAQR
PEELLKTVSYKACLPPGLRDLIQGLSFVTRKRIRRTVRRALRRVVACQADRHSLMAWALL
KITAVTRCFLLQFGFLSDPQIQPYISSPRPSKPFCDFQEIVDISIKQAPRGPSGEHRLVT
VTRTDNQILEAEFPGLPAALSFVALVDGYFRLTADSRHFFCKEVAPPRLLEEVAEQCHGP
ITLDFAVNKLKTGGSLPGSYVLRRSPQDFDSFLLTVCVQTPLGPDYKGCLIRCDPTGTFS
LAGLGRPHSSLRELLAACWDGGLHVDGVALNLTSCCTPKPKEKSNLIVVRRGCTPPTPSL
VQPPSRCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGHRHEAVDGEARETEVLLKVMD
AKHKNCMESFLEAASLMSQVSYQHLVFLHGVCMAGDSIMVQEFVRLGALDTYLRKCGHLV
PASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGADGSPPFIKLSDPGVSPAVL
SLEMLTDRIPWVAPECLQEAHTLGLEADKWGFGATVWEVFSGVTMPISMLDPAKKLQFYQ
ERQQLPAPKWTELALLIQQCMAYERGLRPSFRGIIRDLNSLITSDYELLSDPTPGALAPR
DGLWNGAQLYACQDPTIYEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQH
SGPEQQRDFQREVQILRALHSDFIVKYRGETERPRRPDLRLVHGVTCQGRLADFLQEQQR
RFKPAVGLGSRWEWGGFQYLGSQRCVRDLAARILVESETHVKIADFRLAKLLPLDKDYYV
VREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYSDKSCSPSAEFLRMMGCER
DAPALCRLLELLAEGQRLPAPPACPAEVHELMKLCWAPSPQDRPPFSALGPQLEALWSGS
RG
Download sequence
Identical sequences F7B2N9
ENSECAP00000016316 9796.ENSECAP00000016316 ENSECAP00000016316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]