SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7B2Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7B2Z2
Domain Number 1 Region: 491-549
Classification Level Classification E-value
Superfamily UBA-like 4.59e-19
Family CUE domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7B2Z2
Sequence length 781
Comment (tr|F7B2Z2|F7B2Z2_MONDO) Activating signal cointegrator 1 complex subunit 2 {ECO:0000313|Ensembl:ENSMODP00000011250} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ASCC2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MNEKWLPSRSFQSSQRNETGGGDPSKMPTLPLDELQITEKDPQTGKLRTVPALHPDQKAD
RCFVIYKAPPVDNCAAGVEEYLERAAFIADDLDWLLALPHDKFWCQVIFDETLQKCLDSY
LRHAPRKFDELSAPPSAVSDMQKRLHRSVFLTFLRMSTHKESKDHFISPCAFGEILYNNF
LFDIPKMLDLCVLFGKGNGPLLQKMIENIFIQQSSYYNDLDETVPTILQVLSDILQRCGL
QSEGASTEPQRLEEKVRINPGAMPLQELRDVVLYLCDTATTLWAFLDVFPLACQTFQKHD
FCSRLASFYELSIPELESAIKKRRREDSKLLADLWQRFSHSRKKLVEVFHILINQICLLP
ILESSCENIQAFIEDFLQIFSSLLQEKRFLRDYDELFPVVDDVSLLQQASSALDETRTAY
ILQAVEGAWEGVDRKKASTTKDSSPSKAPERPRASEPSPRAAPTQPKPANHEDECAGAAA
AAPAATARISGVELDSLISQVKDLLPDLGEGFILACLEHYGYSTEQVINNILEERLAPAL
SGLDRSLNRQMQPGPTPLVNSRHNVFQNDEFDVFSRDSVDLSRVQKGRRKGENTRSLLND
KRVVQEQRERYSQYSMVVDEVPVQEGAAEGQLCRDDYEDEYDDTYDGNQVGANDADSDDE
LISRRPFTTPQVLRTKVPHEGPEEEEEEEEEAEEEGPKPDHFIQDPAVLREKAEAQRMAY
LARRGYRHDGSSTVTGNPRGHGQSRETTQERRRKEANKGARANHNRRLMADRKRTKGMIP
S
Download sequence
Identical sequences F7B2Z2
ENSMODP00000011250 XP_007490584.1.35504 XP_016288027.1.35504 XP_016288028.1.35504 ENSMODP00000011250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]