SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7B726 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7B726
Domain Number 1 Region: 483-737
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-49
Family YWTD domain 0.00000427
Further Details:      
 
Domain Number 2 Region: 46-304
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-36
Family YWTD domain 0.0000765
Further Details:      
 
Domain Number 3 Region: 401-476,733-782
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000001
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 972-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.0009
Further Details:      
 
Domain Number 5 Region: 349-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000339
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 870-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000218
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 7 Region: 917-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 832-885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000059
Family EGF-type module 0.038
Further Details:      
 
Domain Number 9 Region: 312-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000352
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7B726
Sequence length 1210
Comment (tr|F7B726|F7B726_HORSE) Pro-epidermal growth factor {ECO:0000256|PIRNR:PIRNR001778} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=EGF OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MLLFLSTLLPAVFAAAFVSVSARPRWDCPAGPPSGKGHSPCVGPVPFLIFSYGNSIFRID
LEGTNHEQLVTDAGISVIMDFHYNKGRIYWVDLARQLLQSVLLNGTRQERICNIERNVSG
MAINWINEELIWSNQEEGVITVTDMKGNNSRVLLGTLKSPANVAVDPVERLLFWSSEAAG
SLHRADLNGVEEKVLLETSGKITAVSLDVLEKRLFWIQYDREGDNSRVCSSDYDGGSVRC
CKHLTQHNLVAVSLFGDRIFYSTWRKQTIEIADKYTGKDVVRINLSRSFAPPAGIKAVHP
LMQPEADGGAQASDQKVCKLRKSDCRGSVCGQDPKSHLCACVEGYTLSQDGKSCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHELISCPSNASECSHDCVLTSDGPL
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCIPLSPASWECSCFPGYDLQLDQKSCAASG
PQPFLLFANSKDIRHMRFDGTDYGILLSQQMGAVFALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLVEEAVDVPEGLAVDWIGRKLYWTDRGKALIEGSDLNGKFREIIVREDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGTGRLVIVSSDLAWPSGITIDYLTDKLYWCD
AKKSVIEMADLDGSKRRRLAQNDVGHPFAVAVFEDHVWFSDWTVPSVIRVNKRTGKNRVR
LRGSMLKPSSLVIVHPLAKPGADPCSHQNGGCEHTCKERFGTAQCLCREGFMKAPDGKMC
LALNGHQILAAVCSEADLSGQTTPLGILSRSRGCEDNISESQQMLVAEIMVSDDDDCGPV
RCGPHAQCVSEGEEAICQCFKGFAGDGQLCSDVDECEVGNLVCPHPSSRCVNTEGGYVCQ
CSEGYRGDGMHCLDIDECQLGMHTCGENASCTNTEGNYTCLCAGGLSGPGWICPNSTVPS
PPREDGHYSVRNSYQECSQSYDGYCLHGGKCVYLVQVDTHACNCVVGYVGERCQHQDLRW
WELRHTGHGWPRSITVVAVCMVVLILLLLLGLWGAHYHRAQKLLLKNPKNPYEESSRDMS
GNRPADSEAGMSSCPQPWFVVIKEQQQNLRSGDQPVHPKDGETADVGQFSSLEPGSLQQT
SWRKEPQRYTGTEQGCCIPPSSGKGSGPQAMECSFHLPSYGARPAATGVEKPHSLLSANP
LWQQRAPDPP
Download sequence
Identical sequences F7B726
ENSECAP00000009196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]