SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7B755 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7B755
Domain Number 1 Region: 122-251
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000705
Family cAMP-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7B755
Sequence length 364
Comment (tr|F7B755|F7B755_CALJA) Popeye domain-containing protein 2 {ECO:0000313|EMBL:JAB36460.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=POPDC2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSANSSTVGQLLLQGSACISWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG
YLCCVLWGWFSACGLDIVLWSFLLALVSLLQLAHLVYRLREDTLPEEFDLLYKALYLPLQ
VPLQTYKEIVHCCEEQVLTLATEQTYAMEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLQPSEDGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD
ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPIAADAGPESEKGDEEVCEPSVSPPQAT
PTSLQQTPPCSPPPAATSLPAPPSRARMSRPDSGILASRIPLQSCSQVISRGQAPLAPTH
TPEL
Download sequence
Identical sequences F7B755
ENSCJAP00000016355 ENSCJAP00000016352 XP_002758820.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]