SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7B7A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7B7A9
Domain Number - Region: 158-234
Classification Level Classification E-value
Superfamily SEA domain 0.000275
Family SEA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7B7A9
Sequence length 910
Comment (tr|F7B7A9|F7B7A9_HORSE) Adhesion G protein-coupled receptor F1 {ECO:0000313|Ensembl:ENSECAP00000009183} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=ADGRF1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MRVRVFWLVSIFAIAESRGGFLERRDGIKTKRELTVNEKKPQGAVQEYELLLQVAYGDSK
EKRDLKSFLKLLNPPSLWSNGPMTIIRAKATTYCYNKNGFLRCACEDDYTWFPPSCLDPQ
KCYLHTAGSYQSCDCHLNNLTQSINFCERTKVWGTFKINETFTKDLLNSSSATHSRYTAG
IELQLKEAYKRIPGFESVRVTQFRDGSILAGYEVVGSSSTAELLSAIEQVAEEAKAGLHQ
LFPLEDDSFRVFGKVQCNSIGFGFGSTNDEYTLPCSSGYTGSITARCQPSGWQVLRETCV
LSQLEELKKNFSVIADNATEAAVSSVVRSLSVVIQQSQSTTAGNLASVVSILGNVSSLST
ARHFRVSNSTMEDIIRIADHILNSSSVTNWTVLLREEKHASSQLLETLENISMLVPPTAL
PLNFSREFINWKGIPGSEIQLEKGYNYQTEMLPQNISIPIRGHVLIGSDQFQRSLPETVI
SMASLTMGNILPITQNGNAQVNGPVISTVIQNYTINEIFLIFSKIESNLSQPRCVFWDFS
HLRWNNAGCHLVNETPDTVMCRCTHLTSFSMLMASFVPPAIIPVVKWITFVGLGISIGSL
ILCLIIEALFWKQVKKSQTSHTRHICMVNIALCLLIADVWFIVAATVDTTVNPSGVCIAA
VFFTHLFYLSLFFWMLMLGILLAYRIIFVFHHMAMPSMMAVGFCLGYGCPLIISVITIAV
TQPSDSYKSKDVCWLNWAEGSKPLLAFGVPALTIVAVNLVVVLLVLTKLWRPAVGERLSQ
DYKATIVRMGKSLLILTPLLGLTWGFGIGIMVDRQNPAWHVIFASLNAFQGFFILCFGIL
LDGKLRQLLFNKLSPLSSWKHASKQKSSDLSAKHKFAKPFNPLQHKGAYALSHTGESTSN
IMLTQFSAAE
Download sequence
Identical sequences F7B7A9
ENSECAP00000009183 ENSECAP00000009183 9796.ENSECAP00000009183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]