SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BFU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BFU4
Domain Number 1 Region: 166-414
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-75
Family Protein kinases, catalytic subunit 0.00000000154
Further Details:      
 
Domain Number 2 Region: 28-195
Classification Level Classification E-value
Superfamily SH2 domain 4.56e-29
Family SH2 domain 0.0000437
Further Details:      
 
Domain Number 3 Region: 2-37
Classification Level Classification E-value
Superfamily SH3-domain 0.000000167
Family SH3-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7BFU4
Sequence length 433
Comment (tr|F7BFU4|F7BFU4_MONDO) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
FMALYDYESRTTEDLSFKKSERFQIINNKEGDWWEARSIATGKTGYIPSNYVAPANSIQA
EEWYFGKMGRKDAERASSEGREALRGIFLVRESETTKGTFSLSLRDWDELRGDNVKHYKI
RKLDNAQFDTLQKLVKHYREHADGLCHKLTTVCPTVKPQTQSLAKDAWEIPRESLRLEVK
LGQGCFGEVWMGTWNGMTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEP
IYIVTEFMSKGSLLDFLKEGDGKHLKLPQLVDMAAQIADGMAYIERMNYIHRDLRVANIL
VGDNLVCKIAGFGLARLIEDNEYTARQGAKFPIKWTAPEAVLYGHFTIKSDVWSFGILLT
ELVTKGRVTYPGMVNREVLEQVEWGYRIPCPQDCPESLHELMNLCWNKDPDERPFEYIQS
FLKDYFTATLNLE
Download sequence
Identical sequences F7BFU4
ENSMODP00000025387 ENSMODP00000025387 13616.ENSMODP00000025387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]