SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BGJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BGJ8
Domain Number 1 Region: 113-157
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000549
Family Elafin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 308-392,696-775
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000348
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 3 Region: 510-543,898-945
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000143
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 383-466
Classification Level Classification E-value
Superfamily SEA domain 0.0000837
Family SEA domain 0.019
Further Details:      
 
Weak hits

Sequence:  F7BGJ8
Domain Number - Region: 261-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00443
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 795-866
Classification Level Classification E-value
Superfamily SEA domain 0.0068
Family SEA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7BGJ8
Sequence length 1321
Comment (tr|F7BGJ8|F7BGJ8_HORSE) Uromodulin like 1 {ECO:0000313|Ensembl:ENSECAP00000011750} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=UMODL1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MLRTLGLALLALVSAVGPSQASGFTEKGLSLLSYQLCNYSVTQNVQKVEAVQTSHLTYVP
CGGWIPWRRCPKTVYRTRYLAVEVPEPRNVTDCCKGYEQLGLYCVLPLNRSQEFASRPGV
CPTVGLEAPSSLCTLDADCPGLQKCCPSSRGHHCVSPMPPAAERSPASFWYNVSVLVKMD
FEELQQVDPRLLNHMRLLHSMVTSALWPMDSAVHHLRSAGGDTSTTVSWLLLGLPRPVPV
ANVSAMLDGIVKRLYEVISIQVQDTNECFYDELNACSGRELCLNVEGSYQCLCHPELNHT
CEDCPPIRDHMTLNVTSSSFHVSWSLSSPQSHTFHVQVYKGEELLRSARTRGTTLEVAGL
EAGVLYRVKTSYQRCGAHVTAALTVRTDAQVFQVTVRILDRNVTEKLLDRGSPEYQDFSR
QLLHEVENSFPPAVSDLHRSGKLRVQIVSLQAGSVVVKLRLTVQDPEFPVGVSTLATMLP
PLLASTVFQIDQQGTLVQDWDECADSLEHDCSPAAQCINLEGSYTCRCRTARDANPSRAG
RACEGDVVSPTGGTLSPATGVTAPALGTETTALGLETPTLSPSPRPPWGTPAASQAQTPG
TPPRRAGSSVVEQDRNSTGQGVEEVLQDPSGWLWRNSTMESSFWATPTEGPTGHVVWDTS
LPTRDTSPAPLDPTQPQNSDPGPSGSPDLPLAPSPTSLKTPACVPIPIRGVTVSNVTSTG
FHLAWAADLALHPAFQLTLTSTRSPTVHLETRDASLTLSGLEPGVLHLVEIVAKACETES
ARARLKVRTAAQKLSGTVRIANVEYVESFRNVSSREYQDFLELFFRTVRSSLPATMRRHL
DSGGVQVEVTSITNGSVVVEFNLLLLADVDVREVSAAFLTAFQNASVLEVVRGDTFIWDY
DECDAGEDDCVPGTSCRNTLGSFTCSCSGGAPDFPVEYSGRPCEDDPPGNTTQVPGPEQP
PTPAGTGAASVPGASVSPQGLPQRLNLTGAVRVLCEIEKVAIAVQRRFLQQESIPESSLY
LGHPSCNVSDGNSTHVLLVAGWSECGTVVQSNMTNTVVRTTLRNDLSPEGIIHHLKILSP
IHCAFQNDLLTSSGYTPEWGVYTIIEDLHGAGNFVTEMQLFIGDSPIPQNYSVSASDDVK
IEVGLYKQKSDLKVVLTECWATPSSNARDPIMFGFINNSCPIPNTHTDVIENGNSTKAQF
KLKIFSFVNNAIVYLHCKLRICMESPGTTCKITCNDFRSLRSAESSGTHLMSWGPLIRTT
GDRLCPEPSGLGAGYLVLIVVAIFALVTGAAALLVVRYQRMTGKYIFRTQSDNFSYQVFS
E
Download sequence
Identical sequences F7BGJ8
9796.ENSECAP00000011750 ENSECAP00000011750 ENSECAP00000011750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]