SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BHP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BHP6
Domain Number 1 Region: 204-364
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 1.01e-62
Family DNA-binding protein LAG-1 (CSL) 0.00000567
Further Details:      
 
Domain Number 2 Region: 52-206
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.62e-56
Family DNA-binding protein LAG-1 (CSL) 0.0000419
Further Details:      
 
Domain Number 3 Region: 365-477
Classification Level Classification E-value
Superfamily E set domains 1.51e-35
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7BHP6
Sequence length 517
Comment (tr|F7BHP6|F7BHP6_HORSE) Recombination signal binding protein for immunoglobulin kappa J region like {ECO:0000313|Ensembl:ENSECAP00000011440} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=RBPJL OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MDPVGAADPSAPPGPLTHLNLPDNSEARPQSGADGRSHPGSWTRSSPEHATVLREGVRQC
LQQQCQQTVWILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPVQGQAHQAGETGPTV
CGYMGLDGASGSAAETQKLNFEEQPDSREFGCAKTLFISDADKRKHFRLVLRLVLRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADEHCSQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL
LDVDEPISQLHKCAFQFPGGPPGGGGSYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
IIGTESVEFSFSASLACTREPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGNV
EAETMYRSPRSLVCVVPDVAAFGSDWRWLRTPITVPVSLVRADGLFYPSAFSFTYSPEYS
ARPGPPGAPEPAADADALLESIHHEFTRTNFHLFIQT
Download sequence
Identical sequences F7BHP6
9796.ENSECAP00000011440 ENSECAP00000011440 ENSECAP00000011440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]