SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BIL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BIL4
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 9.79e-72
Family Integrin A (or I) domain 0.000002
Further Details:      
 
Domain Number 2 Region: 1129-1313
Classification Level Classification E-value
Superfamily Fibronectin type III 4.9e-36
Family Fibronectin type III 0.00000368
Further Details:      
 
Domain Number 3 Region: 1509-1710
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-35
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 991-1108
Classification Level Classification E-value
Superfamily CalX-like 1.57e-19
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 5 Region: 625-709
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.83e-17
Family Integrin beta tail domain 0.004
Further Details:      
 
Domain Number 6 Region: 27-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000298
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 8 Region: 580-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Integrin beta EGF-like domains 0.0091
Further Details:      
 
Weak hits

Sequence:  F7BIL4
Domain Number - Region: 504-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00204
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 467-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0725
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7BIL4
Sequence length 1805
Comment (tr|F7BIL4|F7BIL4_HORSE) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=ITGB4 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MAGPHPSPWTRLLLAALLSVSFPGDMANRCKKAQVKSCTECIRVDKDCAYCTDEMFKERR
CNTQAELLAAGCRLESVVVMERSFEITEATQIDTTLRRSQVSPQAMRVRLRPGEEQLFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVNEFRSKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDEECHLDATGTYTQYK
TQDYPSVPTLVRLLGKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALESPRGLKTEITSKVFQKTKTGSFHIRRGEVGTYYVQLRAIEDVDG
THVCQLPLEDQKGNIHLKPSFSDGLRIDVGVICDVCSCELQKEVRSAHCSFNGDFMCGHC
MCNEGWSGKTCNCSTGSLSDTQPCLREDEDKPCSGRGECQCGRCVCYGEGRYEGQFCEYD
NFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGSSCDCPLSNATCIDSNGGICNGRGHCECG
RCHCNQQSLYTDTICEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECSFKVKMVD
KLKKAEEVVEYCSFRDEDDDCTYSYTVEGDGAPGPNSTVLVHRKKDCPPTSFWWLIPLLI
FLLLLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDTVRWKITNNVQRPGFATRVASTNPTELVPYGLSLRLARLCTENLLKPDTRE
CNQLRQEVEENLNEVYRQITGAYKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKQTLL
KLTEKHVEQGAFHELKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPVGTATLGRRLVNITIIKEQASGIVSFEQPEYLVSGGEQVARIPVVRRILDN
GKSQVSYRTQDNTAQGNRDYIPVEGELLFQPGEMWKELQVKLLELQEMDSLLRGRQTRHF
HIQLSNPKFGARLGQPHSATVIIGDPDELDRNLISQTVSSPPPPRGDLGAPQNPNAKAAG
SRKIHFNWLPPPGKPTGYRVKYWIQGDSELEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNEDNRPIGPMKKVLVDSPKKRTLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQSGEDYESFLMYSDDVLRSPAGSQRPSVSDDTEHLVNGRMDF
AYPGSANSLHRMTVANAAYGTHLSPHLPHRVLSTSSTLTRDYHSLTRTEHSHTATLPRDY
STLTSLSSHSLPPIWEHGRSRLPLSWALGSRSRAQMKGFPHSRDSRDSIILAGQPAAPSW
GPGSRLAAGVPNTPTRLVFSALGPTSLKVSWQEPQCDQALQGYSVEYQLLNGGELHRLNI
PNPSQTSVVVEDLLPNHSYVFRVRAQSQEGWGPEREGVITIESQVHPQSPLCPLPGSTFT
LSTPSAPGPLVFTALSPDSLQLSWERPRRPDGDILGYLVTCEMAHGGEPATTFLVDGDSP
ESRLTVPGLSENVPYKFKVQAKTTQGFGPEREGIITIESQDGGPFPQLGSHSGLFQHPLP
GEYSSITTTHTSTIEPFLLDGLTLGSQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTQVDQ
QFFQT
Download sequence
Identical sequences F7BIL4
ENSECAP00000009107 9796.ENSECAP00000009107 ENSECAP00000009107 XP_014594069.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]