SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BK38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BK38
Domain Number 1 Region: 350-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 2 Region: 989-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 3 Region: 880-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 4 Region: 834-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000234
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 941-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000024
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 6 Region: 786-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 7 Region: 525-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 8 Region: 286-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 9 Region: 473-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1041-1095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.0022
Further Details:      
 
Domain Number 11 Region: 413-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1146-1194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 13 Region: 1098-1141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  F7BK38
Domain Number - Region: 1459-1671
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00262
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7BK38
Sequence length 1801
Comment (tr|F7BK38|F7BK38_HORSE) Laminin subunit beta 2 {ECO:0000313|Ensembl:ENSECAP00000019891} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=LAMB2 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MERASGERGRDWRGQPAPWELRLGLLLSVLATALAQALAPDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRAAWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACRKCECHGHAHSCH
FDMAIYLASGNVSGGVCDGCQHNTAGHHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGS
QDGGRCDPHDDPPLGLVSGQCRCKEHVVGSRCQQCRDGFFGLSASDPVGCRRCQCDARGT
VPGGTPCDPNSGTCFCKRLVTGHGCNRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCNEA
TGQCRCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDVQGQVLDVVERLVIPGGAPSWTGL
GFVRLREGQALEFLVASVPRAMDYDLLLRLEPQVPEQWAEMELTVQRPGPVSAHSLCGHV
LPKDDYIPGTLQSDTRYMVLPRPVCLEPGNSYKLHLKLVRTGGSAQPDAPYSGPSLLIDS
LVLLPRVLVLEMFSAGDAAALERRATFERYRCHEEGLLPSKTLPSEACAPLLISLSTLLY
NGALPCQCDPQGSLSSECNPHGGQCLCKPAVVGRRCDLCAPGYYGFGPTGCQACQCSPEG
ALSSLCEGTSGQCPCRPGAFGLRCDRCQRGQWGFPSCQPCVCNGHADECDTHTGTCLGCR
DHTGGEHCERCIAGFYGDPRLPYGGQCRPCPCPEGPGSRQHFATSCHQDGYSQQIVCHCR
AGYTGLRCEACAPGHFGDPSRPGGRCQPCECSGNIDPMDPDACDPHTGQCLRCLHHTEGP
HCAHCKPGFHGQAARQSCHRCTCNLLGTDPQQCPSTDRCNCDPSSGQCPCLPNVQGPSCD
RCAPNFWNLASGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPG
LQCRACDCDPRGIDTPQCHRSTGHCSCRPGMSGVRCDQCARGFSGVFPACHPCHACFGDW
DRVVQDLAARTRRLEQRAQELQQTGVLGAFERSFWHMQEKLGTVQGIVGARNTSAASTAQ
FLEATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSSLERDGLALNLTLRQLDQH
LDLLKHSNFLGAYDSIRHAHSLSAEAERRANTSALTVPSPVSNSAGIRHRTEVLMGAQRE
DFNRKYMANQQALGKLSARTHTLSLTNINELVCGPPGDAPCATSPCGGAGCRDEDGQPRC
GGLSCNGAAAMADLALGRARHTQAELQRALAEGGGILSQVAETRRQAGEAQQQAQAALDK
ANASRGQVEQANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQHLAG
AIAERVRSLADVDTILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRA
QGAAQGAIQGAVVDTQDTEQTLHQVQERMAGAEQALSSAGERAQQLDGLLEALKLKRAGN
SLAASSAEETAGSAQGRAREAEQLLQGPLGDQYQTVRALAERKAQGVLAAQARAEQLRDE
ARGLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTC
Q
Download sequence
Identical sequences F7BK38
XP_001498255.1.31192 9796.ENSECAP00000019891 ENSECAP00000019891 ENSECAP00000019891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]