SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BLG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BLG6
Domain Number 1 Region: 42-339
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-108
Family Inorganic pyrophosphatase 0.0000000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7BLG6
Sequence length 341
Comment (tr|F7BLG6|F7BLG6_CALJA) Pyrophosphatase (inorganic) 2 {ECO:0000313|Ensembl:ENSCJAP00000028963} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PPA2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSALLLLVLRAGRGWRAGVPAAACLQLATSAGTQPRRAMAQYHTEERGEPCSHNYRLFFK
NVTGHYISPFHDIPLKVNSKEENCLPTKKAQNDENDNLFNMIVEIPRWTNAKMEIATEEP
LNPIKHYVKDGKLRYVANIFPYKGYIWNYGTLPQTWEDPCQKDKSTNCCGDNDPIDVCEI
GSKILSCGEVIQVKILGILALIDEGETDWKLIAINVNDPEASKFRDIDDVKKFKPGYLEA
TLNWFRLYKVPDGKPENQFAFNGEFRNKAFALEVVKSTHQCWKALLMKKCNGGTINCTNV
QVSESPFCCTQEEARSLVESVSSSPNKESNKEEQVWHFLGK
Download sequence
Identical sequences F7BLG6
ENSCJAP00000028962 ENSCJAP00000028963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]