SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BMP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BMP6
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-30
Family C-type lectin domain 0.00000232
Further Details:      
 
Domain Number 2 Region: 500-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 255-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000012
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 200-266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000136
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 563-628
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000904
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 377-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 440-505
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 640-706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 9 Region: 322-394
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000688
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 10 Region: 695-760
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 11 Region: 160-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000927
Family EGF-type module 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7BMP6
Sequence length 828
Comment (tr|F7BMP6|F7BMP6_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000009403} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SELP OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MASCLKAIWSWRFHRVVFRSAQLLFFSALIYELVNQREVAAWTYHHSNKTYSWNDSREFC
QKYYTDLVAIQNKNEITYLNDVLPRHSSYYWIGIRKINNNWTWVGTKKTLTKEAENWADN
EPNNKGNNQDCVEIYIKSPRAPGKWNDEPCWKRKRALCYTASCQDTSCSKQGECIETIGN
YTCSCYPGFYGPECEYVTECGEFDLPQHVLMNCSHPLGNFSFNSECSFRCPEGFKLNGPS
KLECLASGMWTNYPPQCVAVQCPPLKTPERGNMTCVHAAKAFQLPSSCSFSCEEGFALVG
PDVVQCTASGVWTASAPVCKAVQCQRLEAPSQGTMDCVHPAAFAYGSSCKFECEAGYRVR
GWDTLNCTGPGQWTGPLPACEAIACEPLESPVHGSMDCSPSLMAFQYNTTCSFHCAEGFV
LRGADVVQCAELGQWTAPAPVCQALQCQDLAPNKAHVNCSHPFGAFRYQSTCSLTCDEGF
LLVGEHELQCLDTGHWSAPLPECRAITCTPLPSPRNGTMTCVRPLGDSSYKSTCQFTCDE
GFSLSGPERLDCTPSGHWTGSPPMCEAIKCPELFAPEWGSLDCSDTHGEFNVGSTCHFSC
NKGFRLEGPNNVECTASGRWTALPPTCEGEKSVPTPEVRCPALITPEQGTMSCRHHLGTF
GLNTTCYFGCKAGFTLTGDSAVRCRPSGQWTAVAPACRAVKCSKLHAIEPVAMNCSNPWG
NFSYESTCSFHCPDGQLLNGSASTACQESGQWSATMPNCQAGPLTIQEALTYMGGAVASA
IGLVMGGTLLVLLRKRFKQKDDGKSPLTAQSDLGTYGVFTNAAFDPSS
Download sequence
Identical sequences F7BMP6
ENSECAP00000009403 9796.ENSECAP00000009403 ENSECAP00000009403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]