SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BNC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BNC5
Domain Number 1 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-23
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.49e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 7 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-20
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 8 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 613-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-18
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 11 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 77-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000935
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7BNC5
Sequence length 665
Comment (tr|F7BNC5|F7BNC5_HORSE) Uncharacterized protein {ECO:0000313|Ensembl:ENSECAP00000016589} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=LOC100055863 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
DSVAIEDVAVNFTPEEWALLDPSQKKLYRDVMWETFRHLASVGITWEDCDLQDQYKDQGR
KVRKHRVGRLCESEEDSQCGENFILLSNLSLNKKTTGAKPWGCSACGRVFMHHSSLKTHI
RCHTEHKTYEYQKYGEKPYQCKKCGKAFTYHSLLQRHERTHSGEKPYECKTCSKAFTSSS
CLQRHERIHTGEKPYECNKCSKAFTCSSHLRLHERIHTGEKPYECNKCSKAFTCSSHLRL
HERIHTGEKPYECKKCSKAFTSSSSLQVHERTHTGEKPYECKTCSKAFTSSSCLQKHERI
HTGEKPYECKRCMKAFASSSCLQKHERIHTGEKPYKCRRCIKAFASSSSLQVHERTHTGE
KPYECKTCSKAFTSSSCLQRHERIHTGEKPYECNKCSKAFTCSSHLRLHERIHTGEKPYE
CKKCSKAFASSSSLQLHERTHTGEKPYECKTCSKAFTSSSCLQKHERIHTGEKPYECKRC
IKAFVSSSCLQKHERIHTGEKPYKCKRCIKAFSSSSSLQRHVRTHTGEKPFECKNCSKAF
SYSGSLRIHERTHSGEKPYECKECNKAFTASKYLRVHERRHTGEKPFECKICGKAFISTS
SRSTHERTHTRGKPYECKICNKTFSYSSCLQRHGRTHTGEKPFECKNCSKAFTSSSSLRI
HERTH
Download sequence
Identical sequences F7BNC5
ENSECAP00000016589 ENSECAP00000016589 9796.ENSECAP00000016589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]