SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BQQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BQQ7
Domain Number 1 Region: 211-357
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-26
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 57-88,138-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-22
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7BQQ7
Sequence length 429
Comment (tr|F7BQQ7|F7BQQ7_CALJA) Potassium two pore domain channel subfamily K member 2 {ECO:0000313|Ensembl:ENSCJAP00000028312} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCNK2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLFLSLVGGNINLILIRTKGVVHMKIFKKWNVSQTKIRIISTIIFILFGCVLF
VALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGL
AYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQR
ATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGE
EIAVIENIK
Download sequence
Identical sequences F7BQQ7
ENSCJAP00000028312 ENSCJAP00000028312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]