SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BQY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BQY4
Domain Number 1 Region: 61-274
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.31e-88
Family Fibrinogen C-terminal domain-like 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7BQY4
Sequence length 275
Comment (tr|F7BQY4|F7BQY4_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000018922} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=FCN2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MELDRAVRVLGPATLLLTFLGLAWAVQAADTCPGERGPPGPPGKAGPPGSKGAPGEPQPC
LTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTIFQRRVDGSVDFYRD
WAAYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNHQFAKYRSFKVADEKEK
YNLVLGAFVEGSAGDSLTSHNNHSFSTKDQDNDLSTGNCAVMYQGAWWYRTCHVSNLNGR
YLRGAHDSFANGINWKSGKGYNYSYKVSEMKVRPA
Download sequence
Identical sequences F7BQY4
ENSMMUP00000018922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]