SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BTP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BTP2
Domain Number 1 Region: 22-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-36
Family Pentraxin (pentaxin) 0.00000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7BTP2
Sequence length 219
Comment (tr|F7BTP2|F7BTP2_MONDO) Pentraxin {ECO:0000256|RuleBase:RU362112} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEKWLLWTLLLITFSRTMALTDLHRKVFLFPASSADSYVTLSPLKNTELQNFTVCLWTYT
ELTRGYSVFSYATQASTNEILLFRDSVGQYSLTVGSEEVTFQVQEPSFTPINICATWASA
SGVAEIWVDGIPLVRKVLKQGYTLSANAMIILGQDQDSYGGGFDINQSFVGEIGNVYMWD
YVVPFHEGKTDCSQANVLNWKKMKYEKMGHVIMVPQLRD
Download sequence
Identical sequences F7BTP2
ENSMODP00000034647 ENSMODP00000034647 13616.ENSMODP00000034647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]