SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BWV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BWV0
Domain Number 1 Region: 307-491
Classification Level Classification E-value
Superfamily Kelch motif 8.63e-49
Family Kelch motif 0.0000374
Further Details:      
 
Domain Number 2 Region: 40-157
Classification Level Classification E-value
Superfamily POZ domain 1.05e-29
Family BTB/POZ domain 0.0026
Further Details:      
 
Weak hits

Sequence:  F7BWV0
Domain Number - Region: 501-575
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00144
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7BWV0
Sequence length 578
Comment (tr|F7BWV0|F7BWV0_XENTR) Kelch like family member 8 {ECO:0000313|Ensembl:ENSXETP00000014050} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=klhl8 OC=Silurana.
Sequence
MASESVLPEQVKPRQAKGRRQIQREKSLTSEVDGDGTFVFEADEAWKEFHRSLLHFYEVG
ELCDVTLKVGSKLIPCHKLVLACVIPYFRAMFLSDMAETKQTLIEIQDFDGDAIEDLVKF
SYSSCVTLTVDNVQPLLYAACILQVELVAKACCEYMKLHFHPSNCLAVRAFAESHNRVDL
MDMADRYACDHFTEVVDCDDFVTMTPQHLYKLLSSGDLNIENEKQVYNAAMKWLHANPQY
HTAWLDEILSQVRLPLLPVEFLMSVVAKEDIIKQNLKCRDLLDEARNYHLYLSNRSLPDF
EYTARTIPRKQTAGVLFCVGGRGGSGDPFRSIECYSVTKNSWFFGPEMNSRRRHVGVISV
GGKVYAVGGHDGNEHLGSMELFDPLTNKWMMKASMNTKRYRRGIALSSLGGPIYAIGGLD
DNTCFNDVERYDIESDHWTSVAPMISPRGGVGSVALMSHVYAVGGNDGVASLSSVERYDP
HLDKWVEVKEMGQRRAGNGVSELHGCLYVVGGFDDNSPLSSVERYDPRMNKWDYVSELTT
PRGGVGIATLMGKIYAVGGHNGNAYLNTVESYDPRINR
Download sequence
Identical sequences F7BWV0
ENSXETP00000014050 ENSXETP00000014050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]