SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7BZG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7BZG2
Domain Number 1 Region: 256-467
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.44e-57
Family Reprolysin-like 0.00053
Further Details:      
 
Domain Number 2 Region: 1514-1572
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000772
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 963-1015
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 1404-1467
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 5 Region: 896-959
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000109
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 843-901
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 7 Region: 1359-1409
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000353
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 1466-1515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000419
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Weak hits

Sequence:  F7BZG2
Domain Number - Region: 584-614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0122
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7BZG2
Sequence length 1635
Comment (tr|F7BZG2|F7BZG2_MONDO) ADAM metallopeptidase with thrombospondin type 1 motif 12 {ECO:0000313|Ensembl:ENSMODP00000025523} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ADAMTS12 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MPWVPRSWVPNIFLVVQFLDFQALCNDRQPQPGAFSFPDKRQEHFFKTLPEYYVVGPVKV
NATGHFVSYDLHHHIPSTGNTRRRRDLEHRADWIYYKIVHEDKDLFFNLTVNREFLFNNY
ILERRYGNLTGAQMESNSGSSCHFHGTVLQSGVGDGIAALSTCRGLTGFFHLPHGDYFIE
PVKMHPLDEGKHHPHIIYKRQVHQDSLRKRWGFPEQKEPACGLNDSRAMFQQEEQQRESW
ERNSMSKKRLSRRSISKERWVETLVVADTKMIEYHGSDSVESYILTIMNMVTGLFHNPSI
GNAIHIVVVRLILLEEEEEGLKIVHHADKTLASFCKWQKSINPKSDLNPAHHDVAVLLTR
KDICAGVNHPCETLGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGREN
DCEPVGRHPYIMSRQLQYDPTPLTWSKCSKDYITRFLDRGWGFCLDDVPQKKGLKSKVIA
PGVIYDIHHQCQLQYGPNATFCQEVENICQTLWCSVKGSCRSKLDAAADGTRCGEKKWCM
AGKCIMGRERNPESIPGGVGGSLCAPSHTDQGTMWGRSSEEILKVLCFIARPKFGGKYCT
GERKRYRLCNIHPCRADVPTFRQMQCSEFDTVPYKNEFYHWFPVFNSEYPCELYCRPIDG
QFSEKMLDAVIDGTPCFEGGNSRNVCINGICKMVGCDYEIDSNATEDRCGVCLGDGSACH
TVKKIFKQKEGFGYVDIGLIPKGARDIRVVEVEEAGNFLAVRSEDPEKYYLNGGFIIQWN
GDYKLAGTVFQYDRKGDLENLRAAGPTNESVWIQLLFQVTNPGIKYEYTIRKDSSSENDV
EKPEYFWQYGSWTECSATCGTGIRRQTARCMKKGRGMVRTTFCDPETQPNGRQKKCYERN
CPPRWWAGEWQACSATCGPLGEKKRTVMCIQTMGSDEQALPAKDCHHLLKPKALVSCNRD
ILCPSDWTVSNWSECTVSCGGGVRIRNVTCAKNNDEPCDFTKKPNSRALCGLQQCPSGRR
LLIPPLKPKRGPISNRRTLPKPKSTPSSPIPPPTLSPRVLTTQMIPESVSLNPMTTITTN
PTMSSKDQDPVGGKLQNNSIPSELDSPVSIVPTESTSQPNPASGTVSIQPKSRNATSEGN
ISHSERTSTPKMDFVAKTDVTPLLPFTTIPVTLQVTPVFDPLPEGPETEVHSGSGEDSDQ
HVDKTTDVSVTWTKNKSLIDQSPLTKYAISMPLQPQPTPSLSEPSTGNSFSTTADGLSPL
TRTSQQPTTPQYGTLDANAIVSKKSSLLQLSPERKIEPMLHEKVSTHMETESMNNKSLSQ
TLEPDLTEEDAKNLIAEGFLLNATNYKHLRMPSPTQSAAYWIVSNWSECSTTCGLGALWR
QVKCSTQIDSDCESIQRPDPAKRCHLRPCASWKVGTWSKCSQNCGGGIKVREARCVNSHD
HRNLRPFHCQLLEDKPQLSTTCNMEPCLEWKTEPWSQCSRSCGGGTQERLVHCPEGRCDW
QTKPNFTRHCNEQPCSHWVEGKWNLCTVSCGGGIQQRSVQCVNSERNKTEDQSLCEHTPK
PLESQKCNEQECRKNTDLLCIKDKLSPSFCQTLKTMGKCSIITLRAQCCYTCASPQTIQP
QWQKNRQGFRKSKLL
Download sequence
Identical sequences F7BZG2
ENSMODP00000025523 ENSMODP00000025523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]