SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7C0F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C0F3
Domain Number 1 Region: 154-381,425-474
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.05e-46
Family LacY-like proton/sugar symporter 0.068
Further Details:      
 
Domain Number 2 Region: 590-731
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.93e-19
Family Glycerol-3-phosphate transporter 0.07
Further Details:      
 
Domain Number 3 Region: 498-578
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000011
Family Pentapeptide repeats 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7C0F3
Sequence length 742
Comment (tr|F7C0F3|F7C0F3_CALJA) Synaptic vesicle glycoprotein 2A {ECO:0000313|EMBL:JAB20679.1, ECO:0000313|Ensembl:ENSCJAP00000001346} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SV2A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDFPA
PTDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTIWFPDMIRHLQAVDY
ASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS
AALALGSSLALKLPETRGQVLQ
Download sequence
Identical sequences F7C0F3
ENSCJAP00000001346 XP_002759902.1.60252 ENSCJAP00000001346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]