SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7C5M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C5M9
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-57
Family Eukaryotic proteases 0.000000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7C5M9
Sequence length 209
Comment (tr|F7C5M9|F7C5M9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000035702} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
ILTAAHTVYPKDSFSQENRSVNVFLGHTDVEEIIRLGPHPVHRVIVHPDYRPEEPNNFEG
DIALLELENSVPLSPNILPICLPDNETLYGNGLMGYVSGFGMENGRLASQLRYVHLPIAK
RDACEAWLQKKNRTEVFSPNMFCAGDRTLKQDACQGDSGGVFAVWDNATERWRATGIVSW
GIGCSKGYGFYTKVLNYMDWIKATIEGDS
Download sequence
Identical sequences F7C5M9
ENSMODP00000035702 ENSMODP00000035702 13616.ENSMODP00000035702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]