SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7C6K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C6K7
Domain Number 1 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 4.31e-37
Family Link domain 0.00000236
Further Details:      
 
Domain Number 2 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-37
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7C6K7
Sequence length 277
Comment (tr|F7C6K7|F7C6K7_MONDO) TNF alpha induced protein 6 {ECO:0000313|Ensembl:ENSMODP00000004406} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TNFAIP6 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MIALIYFFVLLWDEAQSWGFKDGIFHNSIWLEQAAGVYHREARAGKYQLTYAEAKAVCEY
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGYGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIIKSPGYPKEYEDNQICYWHIRLKYGQRIHLSFLNF
NLEDDIACLADYLEIYDSYDDIHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QLKYVTVDTTPKTGEGKNASTNSHGNKNFLAGRFSHL
Download sequence
Identical sequences F7C6K7
XP_001365272.1.35504 13616.ENSMODP00000004406 ENSMODP00000004406 ENSMODP00000004406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]