SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7C728 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C728
Domain Number 1 Region: 191-321
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.29e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 60-198
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.9e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7C728
Sequence length 326
Comment (tr|F7C728|F7C728_MACMU) Apoptosis-inducing factor 1, mitochondrial {ECO:0000313|Ensembl:ENSMMUP00000006570} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=AIFM1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPARALGTEVIQLFPEKGNMGKILPEY
LSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELA
KTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGE
NMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPRSATEQSGTG
IRSESETESEASEIAIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPI
ARKIIKDGEQHEDLNEVAKLFNIHED
Download sequence
Identical sequences A0A2K5X6R6 A0A2K6DRL2 F7C728
ENSMMUP00000006570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]