SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7C7V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C7V8
Domain Number 1 Region: 62-493
Classification Level Classification E-value
Superfamily Sema domain 1.15e-110
Family Sema domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 490-527
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000558
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 547-613
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000116
Family I set domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7C7V8
Sequence length 663
Comment (tr|F7C7V8|F7C7V8_HORSE) Semaphorin 7A (John Milton Hagen blood group) {ECO:0000313|Ensembl:ENSECAP00000000171} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=SEMA7A OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MTPPPPRCAALGAPRARVPGPLARSGFPLRLLLLLVWTAATTQGHPRSPRISAVWKGRAG
QDRVDFGSAEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVHTVNIGSTKGSCLDK
LDCENYITLLERQGEGLLVCGTNARRPSCWNLVNGTVESLGERRGYAPFSPDENSLVLFD
GDEVYSTIRKQEYNGKIPRFRRIQGEIELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYF
FREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDTATNRNFNRL
QDVFLLPDPNGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHTGLPNPRP
GKCLPDRQPIPTETFQVADSHPEVAQRVEPMGPLKTPLFHSKYHYQKVVVHRMHASRGET
FRVLYLTTDRGTIHKVVESGERERSLVFNIVEIQPFRHAAAIQAMSLDADRRKLYVSSQW
EVSQVPLDLCEVYGGGCHGCLMARDPYCGWDQGRCVSIYSSQEPVLQSINPAEPHKECPN
PKPDEAPLQKVSLAPNSRYYLSCPMESRHAIYSWRHGKNVEQSCEPGHQSPNCILFIENL
TTDQYGHYHCEAQEGSFFHEAQHWELLREDGATAEHLLGHARTLAASLWLGALPMLVLAL
FVH
Download sequence
Identical sequences F7C7V8
9796.ENSECAP00000000171 ENSECAP00000000171 ENSECAP00000000171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]