SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7C7X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C7X8
Domain Number 1 Region: 221-335
Classification Level Classification E-value
Superfamily Acid proteases 7.13e-28
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 4-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.65e-17
Family Ubiquitin-related 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7C7X8
Sequence length 398
Comment (tr|F7C7X8|F7C7X8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000004298} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100018186 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRS
LASYGLKDGDVVILRQKENAEPRPSVQFPSLPRIDFSSIAVPGTSGSRPHQQPAQPPRTS
PADTASSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFTKVLIEQQQD
RARREQERIRLFAADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCK
VNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQI
EGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGTQTTFLPEGELPEC
ARLAYGSGRDDIRPEEIADQELAEALQKSVEDAERQKP
Download sequence
Identical sequences F7C7X8
ENSMODP00000004298 XP_007491732.1.35504 ENSMODP00000004298 13616.ENSMODP00000004298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]