SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7C941 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7C941
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-33
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 174-297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-19
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7C941
Sequence length 525
Comment (tr|F7C941|F7C941_MONDO) Neuropilin and tolloid like 2 {ECO:0000313|Ensembl:ENSMODP00000016097} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=NETO2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MALEKLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASP
NYPESYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEIRDGPFGFSPLIDR
YCGVKSPSLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEDKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLQTGIGVIRMWADEGSRLSRFRMLFTSFVDPPCTGS
TFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGITSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELE
NYQKMRRSSTASRCIHDHHCGSQASNVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKK
SSYTFKQSHECSEQAIEDRVMEEIPCEIYVRGREDSAQGSMSIDF
Download sequence
Identical sequences F7C941
ENSMODP00000016097 XP_007474884.1.35504 ENSMODP00000016097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]