SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CAV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CAV0
Domain Number 1 Region: 1152-1261
Classification Level Classification E-value
Superfamily PDZ domain-like 1.2e-30
Family PDZ domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 1558-1737
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.88e-28
Family Nucleotide and nucleoside kinases 0.00014
Further Details:      
 
Domain Number 3 Region: 1315-1407
Classification Level Classification E-value
Superfamily PDZ domain-like 8.41e-17
Family PDZ domain 0.0091
Further Details:      
 
Domain Number 4 Region: 501-613
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-16
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 5 Region: 625-699
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-16
Family PDZ domain 0.027
Further Details:      
 
Domain Number 6 Region: 1417-1485
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000971
Family SH3-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CAV0
Sequence length 1740
Comment (tr|F7CAV0|F7CAV0_CALJA) Discs large MAGUK scaffold protein 5 {ECO:0000313|Ensembl:ENSCJAP00000001830} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=DLG5 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
GSTYSVLSTMPSDSESSSSLSSVGTTGKAPSPPPLLTDRQVNEKVENLSIQLRLMTRERN
ELRKRLAFATHGTAFDKRARPYHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEV
AKETDFYHTLHSRLLSDQTRLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEI
GDLRAQQQQVVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNADLSRL
EQLGEENQRLLKQTEMLTQQRDTAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEME
LLQSELTELRTTQVKTVKESEKYREERDAVYSEYKLIMSERDQVISELDKLQTEVELAES
KLKSSTSEKKAASEEMEALRQIKDTVTMDAGRANKEVEILRKQCKALCQELKEALQEADV
AKCRRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRE
LKELKKSRLESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDIDLKALGF
DMAEGVNEPCFPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLN
GEGAINMVVRRRKSLGGKVVTPLHINLSGQKDSGISLENGVYAAAVLPGSPAAKEGSLAV
GDRIVAINGIALDNKSLNECESLLRSCQDSLTLSLLKVRAACASALRVGSVGKAPTPHSQ
HYLQGHGTLENRVGIYRVHLKLKKQQSRPSCGEAQAKVVRSDVEGGKGRGVTCYDILFCS
IVTDIDSKDNLMVPLWTFIVLFYIYEKINHRKYIFDSRTLCRCSGSGPAHSPSPPEDAMP
LTPPIPLRRDSIKFQHSWRPALSQSHSGEQLSSTSPPSALPDRDPGEPMHASPPRKARVR
IASSYYPEEMETPPLPPKKSCDEDLTSQKADELGQKRRRPKSAPSFRPKLAPVVIPAQFL
EVELSPRVRKYQRYSSGHSSRHSNPPLYPSRQSVGTVPRSVTPSTTMSSILRNPIYTVRS
HRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRACSDYSEMRATHGSNSLPSSARL
GSSSNLQFKAERIKIPSTPRYPRSVVGSDRGSLSHSECSTPPQSPLNIDTLSSCSQSQTS
ASTLPRIAVNPASLGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTMGS
IAHQAGLEYGDQLLEVQWHNLRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSQSS
SHLDPAGTHSTLQGSGTTTPEHPSVIDPLMEQDEGPGTPLAKQSTPSSRIAGDTNKKTLE
PRVVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGSLDMRNKT
VEEVYVEMLKPRDGIRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADMEHELSFKKDDI
LYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKT
LSAAARRSFFRRKHKHKRSGSKDGKDLLALEAFSSDSIPLFEDSVSLAYQRVQKVDCTAL
RPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFD
VTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRD
KVTQRHSKEQFEAAQKVEQEYSRYFTGVIQGGALSSICPQILAMVNQEQNKVLWIPACPL
Download sequence
Identical sequences F7CAV0
ENSCJAP00000001830 ENSCJAP00000001829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]