SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7CBD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7CBD7
Domain Number 1 Region: 396-654
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-59
Family YWTD domain 0.000000979
Further Details:      
 
Domain Number 2 Region: 700-956
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-55
Family YWTD domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 1308-1564
Classification Level Classification E-value
Superfamily YWTD domain 8.37e-55
Family YWTD domain 0.00000307
Further Details:      
 
Domain Number 4 Region: 1007-1260
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-48
Family YWTD domain 0.00000623
Further Details:      
 
Domain Number 5 Region: 313-388,646-694
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-20
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 181-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 7 Region: 219-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 265-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000105
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 27-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 10 Region: 102-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 11 Region: 63-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 12 Region: 963-1015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family EGF-type module 0.014
Further Details:      
 
Domain Number 13 Region: 2-27
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000419
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 1270-1302,1569-1599
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0001
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7CBD7
Sequence length 1852
Comment (tr|F7CBD7|F7CBD7_XENTR) LDL receptor-related protein 4 {ECO:0000313|Ensembl:ENSXETP00000011107} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=lrp4 OC=Silurana.
Sequence
CTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSD
EQDCPPRECEEDEFSCQNGYCIRSLWHCDGDNDCGDNSDEQCDMRKCSEKEFGCADGSCI
AEHWFCDGDTDCKDGSDEESCRAGPPEAPCALARRQPRQGLCLWCNWEGSPGQGYAEFLL
ASHQPCRSGEFMCNSGLCINSGWRCDGDSDCDDQSDEKNCTTSVCTSDQFRCSSGRCVRL
SWRCDGEDDCSDNSDERGCEKTGSPQCAQDQFLCSNGRCIGQRKLCNGVNDCGDGSDESP
HQNCRPRTGEENCNHQNGGCEQKCQTVRGLVQCTCQTGYRLRDDGRTCQDVDECAEEGYC
SQGCSNSQGGFQCWCEAGYQLRPDKRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLN
NLENAIALDFHHEHELVFWSDVTLDRIMRANLNGSNVEEVVSTGLESPESGGLAIDWIHD
KLFWTDSGTSRIEVSNLDGSHRKVLLWNNLEKPRAIALHPMEGTIYWTDWGNVPRIEYSS
MDGSNRRVIADTHLFWPNGLTIDYAGHRIYWVDAKHHVIERADLDGSNRKAVISQGLPHP
FAITVFEDSLYWTDWHTKSINSANKFTGKNQEVIRSKLHFPMDIHTLHPQRQPTGANRCG
VDNGGCSHLCLPGGQTFSCACPTGFRKTGLNTCAKSLDKFLLFARRTDIRRISFDTDDLS
DDVIPLSDVRSAVALDWDATEDLMYWTDITTDSINRAKWDGSEQEVIIDTSLESPAGLAI
DWVTHKLYWTDAGTDRIEVSNTDGSLRSVLIWENLDRPRDIVVDPIGGFMYWTDWGANPK
IERAGMDASSRLVIISSNLTWPNGLAIDYESERLYWADAGMKTIESAKLNGADRMVLIGT
DLPHPFGLTLYGDQIYWTDWQSKSIETADRKTGLGRRTVQANLENLMDIHVFHRHRTQVP
SACSIDNGGCSHICLLAPKPKGHSCACPTGVNLLSDGRTCSSGMDRFLIFARRTDIRSVS
LDIPYFADVVVPINATMKNTIAVGVDPLKGLIYWADSTLRKISRAALDGSNHQDIITTGL
VTTDGLAVDAIGRKLYWTDTGTNRIEVANLDGTMRKVLVWQNLGSPRAIALYHEMGYMYW
SDWGENAKLERAGMDGSERMVLISLNLGWPNGLAVDKAGSQLLWADAHTERIEASDLMGR
NRRILVSPVQHPYGLTLLDAHIYWTDWQTRSIQRADKDTGGNIIVVRDNLPGLMDIQAVD
RTHALVFAICFIRCHLCLPNSTSFSCACPTGIQLKDDGKTCNPSPDTYLLFSSRGSIRRI
SLDTEDHTDVYVPIPELHNVISLDYDSVEGKIYYTDVFLDVIRRSDLTGTGMETVIGEGL
KTTDGLAVDWVARNLYWTDTGRNTIEVSRLDGRHRKVLVNNSLDEPRAIAVFPRKGFLFW
TDWGQVAKIERAHLDGSDRRTIINTDLGWPNGLTLDYDSRRIYWVDAHLDRIENADLNGK
MRHVLISQVSHPFALTQEGRWIYWTDWQTKSIQRVDKFSGRNKETVLGNVEGLMDIIVVS
PHRQTGINPCGINNGGCSHLCFARSIDYVCACPDEPDSEPCFLLPGYQPSDPHPTNSSEK
SSGPFISNTESDQDDSTLRATPRSCSDETGSPVLCASNGPVPAHAGDRLRVPYIIAGSLS
LLCLLLLLCALLIYSRHRRAKLSDQGLGTLTYSNPSYRTSTQEVKIEAVQKMNTSLHRHR
KEAVPDSGFTKEKIRILEGFGLLSGEECEWDHLKQVKPSRTSILRDHVCIKTDTVSLQAS
TASLDLTETQQLLQEEQSESSSVVLPPSPERRVSLPDTGWRVKHSPSTESDV
Download sequence
Identical sequences F7CBD7
ENSXETP00000011107 ENSXETP00000011107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]